PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03254.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 270aa    MW: 29746.2 Da    PI: 10.6491
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03254.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.93.2e-152065147
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                  rg W + Ed++l++++ ++G+  W++Ia+ +  gR++k+c++rw++ 
  Zmw_sc03254.1.g00010.1.sm.mk 20 RGHWRPGEDQKLKELIDKYGPQKWNSIAENLE-GRSGKSCRLRWFNQ 65
                                  899*****************************.***********996 PP

2Myb_DNA-binding60.34.3e-1973115246
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                    ++T+eE+e+l  a++ +G++ W++Iar+++ gRt++ +k++w+ 
  Zmw_sc03254.1.g00010.1.sm.mk  73 RPFTEEEEERLFAAHRVHGNK-WALIARHVP-GRTDNAVKNHWHV 115
                                   69*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.0871566IPR017930Myb domain
SuperFamilySSF466891.31E-2818113IPR009057Homeodomain-like
SMARTSM007171.2E-121968IPR001005SANT/Myb domain
PfamPF002496.0E-152065IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-262173IPR009057Homeodomain-like
CDDcd001672.27E-122364No hitNo description
PROSITE profilePS5129427.97667121IPR017930Myb domain
SMARTSM007171.7E-1671119IPR001005SANT/Myb domain
PfamPF002494.3E-1672114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-2274119IPR009057Homeodomain-like
CDDcd001671.15E-1374114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTSSSATNPS NGAKSSSCPR GHWRPGEDQK LKELIDKYGP QKWNSIAENL EGRSGKSCRL  60
RWFNQLDPRI NKRPFTEEEE ERLFAAHRVH GNKWALIARH VPGRTDNAVK NHWHVIMARR  120
SRERSRLLSR AAQSSSSPSL AYPFVASAAR AAGRSLCFGF SKTSLGSSGG LSGSSLAART  180
PFFWGYDATG GGRGASFEVA RYYSYGGKQP AAPLSVTFSS QREARAVDMR HGLHSGNDTK  240
KKDYHVDGDE TLSTRKDMPF FDFLGVGVSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-33201207107B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004979129.11e-104PREDICTED: trichome differentiation protein GL1-like
TrEMBLK3ZJJ81e-104K3ZJJ8_SETIT; Uncharacterized protein
STRINGSi026751m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260